5ELR
Structure of the kh-qua2 domain of t-star in complex with aauaau rna
PDB DOI: 10.2210/pdb5elr/pdb
Classification: RNA BINDING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2015-11-05 Deposition Author(s): Dominguez, C. , Feracci, M.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.3 Å
Structure of the kh-qua2 domain of t-star in complex with aauaau rna
Primary Citation of Related Structures: 5ELR
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| RNA (5'-R(*AP*AP*UP*AP*AP*U)-3') | b | 6 | NA | AAUAAU |
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| KH domain-containing, RNA-binding, signal transduction-associated protein 3 | C | 136 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GAINKNMKLGQKVLIPVKQFPKFNFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKYFHLNDDLHVLIEVFAPPAEAYARMGHALEEIKKFLIPDYNDEIRQAQLQELTYLNGGSENADV |
| KH domain-containing, RNA-binding, signal transduction-associated protein 3 | D | 136 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GAINKNMKLGQKVLIPVKQFPKFNFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKYFHLNDDLHVLIEVFAPPAEAYARMGHALEEIKKFLIPDYNDEIRQAQLQELTYLNGGSENADV |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2015-11-05 Deposition Author(s): Dominguez, C. , Feracci, M.