Crystal structure of a chimeric c-src-sh3 domain with the sequence of the rt-loop from the abl-sh3 domain at ph 6.5
PDB DOI: 10.2210/pdb5eca/pdb
Classification: TRANSFERASE Organism(s): Gallus Gallus
Deposited: 2015-10-20 Deposition Author(s): Camara-Artigas, A.
Crystal structure of a chimeric c-src-sh3 domain with the sequence of the rt-loop from the abl-sh3 domain at ph 6.5
Primary Citation of Related Structures: 5ECA
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Proto-oncogene tyrosine-protein kinase Src | A | 60 | Gallus Gallus | SHMTFVALYDYVASGETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-10-20 Deposition Author(s): Camara-Artigas, A.