Crystal structure of cpsrp43 chromodomain 3
PDB DOI: 10.2210/pdb5e4x/pdb
Classification: TRANSPORT PROTEIN Organism(s): Arabidopsis Thaliana
Deposited: 2015-10-07 Deposition Author(s): Ahmed, Y.L. , Horn, A. , Sinning, I. , Wild, K.
Crystal structure of cpsrp43 chromodomain 3
Ahmed, Y.L. , Horn, A. , Sinning, I. , Wild, K.
Primary Citation of Related Structures: 5E4X
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Signal recognition particle 43 kDa protein, chloroplastic | A | 50 | Arabidopsis Thaliana | YAVAESVIGKRVGDDGKTIEYLVKWTDMSDATWEPQDNVDSTLVLLYQQQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-10-07 Deposition Author(s): Ahmed, Y.L. , Horn, A. , Sinning, I. , Wild, K.