Crystal structure of c-terminal tudor domain in pcra/uvrd helicase
PDB DOI: 10.2210/pdb5dma/pdb
Classification: HYDROLASE Organism(s): Geobacillus Stearothermophilus
Deposited: 2015-09-08 Deposition Author(s): Dillingham, M. , Lin, C.L. , Wigley, D.
Method: X-RAY DIFFRACTION Resolution: 1.53 Å
Crystal structure of c-terminal tudor domain in pcra/uvrd helicase
Dillingham, M. , Lin, C.L. , Wigley, D.
Primary Citation of Related Structures: 5DMA
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ATP-dependent DNA helicase PcrA | A | 56 | Geobacillus Stearothermophilus | PGGGWKVGDRANHRKWGIGTVVSVRGGGDDQELDIAFPSPIGIKRLLAKFAPIEKV |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-09-08 Deposition Author(s): Dillingham, M. , Lin, C.L. , Wigley, D.