Crystal structure of a 5'-methylthioadenosine/s-adenosylhomocysteine (mta/sah) nucleosidase (mtan) from colwellia psychrerythraea 34h (cps_4743, target psi-029300) in complex with adenine at 2.27 a resolution
PDB DOI: 10.2210/pdb5dk6/pdb
Classification: HYDROLASE Organism(s): Psychrobacter Cryohalolentis K5
Deposited: 2015-09-03 Deposition Author(s): Ahmed, M. , Almo, S.C. , Bhosle, R. , Bonanno, J.B. , Celikgil, A. , Chamala, S. , Chan, M.K. , Evans, B. , Fiser, A. , Garforth, S. , Gizzi, A. , Hillerich, B. , Himmel, D.M. , Kar, A. , Lafluer, J. , Lim, S. , Love, J. , Matikainen, B. , New York Structural Genomics Research Consortium (Nysgrc) , Patel, H. , Seidel, R.D. , Toro, R. , Villegas, G.
Crystal structure of a 5'-methylthioadenosine/s-adenosylhomocysteine (mta/sah) nucleosidase (mtan) from colwellia psychrerythraea 34h (cps_4743, target psi-029300) in complex with adenine at 2.27 a resolution
Ahmed, M. , Almo, S.C. , Bhosle, R. , Bonanno, J.B. , Celikgil, A. , Chamala, S. , Chan, M.K. , Evans, B. , Fiser, A. , Garforth, S. , Gizzi, A. , Hillerich, B. , Himmel, D.M. , Kar, A. , Lafluer, J. , Lim, S. , Love, J. , Matikainen, B. , New York Structural Genomics Research Consortium (Nysgrc) , Patel, H. , Seidel, R.D. , Toro, R. , Villegas, G.
Primary Citation of Related Structures: 5DK6
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | A | 265 | Psychrobacter Cryohalolentis K5 | MHHHHHHSSGVDLGTENLYFQSMKAGIIGAMEPEVAILKEKLTDAKSTEHAGYTFHQGQLDGSDVVIVQSGIGKVAAALATAILIDRFQVDYVVNTGSAGGFDASLKVGDIVVSSEVRYHDVDLTAFGYEIGQLPANPAAFMPHDDLVAAAKKGIEQLSQTAGENIKAVTGLITTGDTFMTKEEDVAKARANFPTMAAVEMEGAAIAQACLQLKTPFVVIRSLSDIAGKESPHTFEEYLETAAVNSSQLVLNMLGQLKGKVLSAA |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-09-03 Deposition Author(s): Ahmed, M. , Almo, S.C. , Bhosle, R. , Bonanno, J.B. , Celikgil, A. , Chamala, S. , Chan, M.K. , Evans, B. , Fiser, A. , Garforth, S. , Gizzi, A. , Hillerich, B. , Himmel, D.M. , Kar, A. , Lafluer, J. , Lim, S. , Love, J. , Matikainen, B. , New York Structural Genomics Research Consortium (Nysgrc) , Patel, H. , Seidel, R.D. , Toro, R. , Villegas, G.