Hiv-1 rev ntd dimers with variable crossing angles
PDB DOI: 10.2210/pdb5dhz/pdb
Classification: IMMUNE SYSTEM Organism(s): Human Immunodeficiency Virus 1 , Oryctolagus Cuniculus
Deposited: 2015-08-31 Deposition Author(s): Dimattia, M.A. , Grimes, J.M. , Steven, A.C. , Stuart, D.I. , Watts, N.R. , Wingfield, P.T.
Method: X-RAY DIFFRACTION Resolution: 4.3 Å
Hiv-1 rev ntd dimers with variable crossing angles
Dimattia, M.A. , Grimes, J.M. , Steven, A.C. , Stuart, D.I. , Watts, N.R. , Wingfield, P.T.
Primary Citation of Related Structures: 5DHZ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Anti-Rev Antibody Fab single-chain variable fragment, heavy chain | H | 117 | Human Immunodeficiency Virus 1 , Oryctolagus Cuniculus | QEQLVESGGRLVTPGTALTLTCKVSGFSLSGFWLNWVRQAPGKGLEWVGAIYRGSGSEWYASWAKGRFTISDTSTTVTLKLTSPTTEDTATYFCAADTTDNGYFTIWGPGTLVTVSS |
Anti-Rev Antibody Fab single-chain variable fragment, light chain | L | 110 | Human Immunodeficiency Virus 1 , Oryctolagus Cuniculus | ELVMTQTPSSVSEPVGGTVTIKCQASQSISSWLSWYQQKPGQPPKLLIYDASNLASGVPSRFMGSGSGTEYTLTISGVQREDAATYYCLGGYPAASYRTAFGGGTELEII |
Protein Rev | M | 65 | Human Immunodeficiency Virus 1 , Oryctolagus Cuniculus | MAGRSGDSDEDLLKAVRLIKFLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERILSTYLG |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-08-31 Deposition Author(s): Dimattia, M.A. , Grimes, J.M. , Steven, A.C. , Stuart, D.I. , Watts, N.R. , Wingfield, P.T.