Crystal structure of human keap1 btb domain in complex with small molecule tx64063
PDB DOI: 10.2210/pdb5daf/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2015-08-19 Deposition Author(s): Bender, C.F. , Dulubova, I. , Ferguson, D.A. , Huerta, C. , Jiang, X. , Probst, B. , Stoll, V.S. , Swinger, K.K. , Thomas, P.J. , Trevino, I. , Visnick, M. , Wigley, W.C.
Crystal structure of human keap1 btb domain in complex with small molecule tx64063
Bender, C.F. , Dulubova, I. , Ferguson, D.A. , Huerta, C. , Jiang, X. , Probst, B. , Stoll, V.S. , Swinger, K.K. , Thomas, P.J. , Trevino, I. , Visnick, M. , Wigley, W.C.
Primary Citation of Related Structures: 5DAF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Kelch-like ECH-associated protein 1 | A | 140 | Homo Sapiens | GSHMASNRTFSYTLEDHTKQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLDPS |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-08-19 Deposition Author(s): Bender, C.F. , Dulubova, I. , Ferguson, D.A. , Huerta, C. , Jiang, X. , Probst, B. , Stoll, V.S. , Swinger, K.K. , Thomas, P.J. , Trevino, I. , Visnick, M. , Wigley, W.C.