Crystal structure of hinmlr, a merr family regulator lacking the sensor domain, bound to promoter dna
PDB DOI: 10.2210/pdb5d8c/pdb
Classification: transcription/dna Organism(s): Influenza A Virus (A/Bilthoven/17938/1969(H3N2)) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2015-08-17 Deposition Author(s): Chang, C.W. , Chen, N.H. , Counago, R.M. , Djoko, K.Y. , Kobe, B. , Mcewan, A.G.
Crystal structure of hinmlr, a merr family regulator lacking the sensor domain, bound to promoter dna
Chang, C.W. , Chen, N.H. , Counago, R.M. , Djoko, K.Y. , Kobe, B. , Mcewan, A.G.
Primary Citation of Related Structures: 5D8C
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
MerR family regulator protein | A | 137 | Influenza A Virus (A/Bilthoven/17938/1969(H3N2)) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | NAMTYTTAKAAEKIGISAYTLRFYDKEGLLPNVGRDEYGNRRFTDKDLQWLSLLQCLKNTGMSLKDIKRFAECTIIGDDTIEERLSLFENQTKNVKCQIAELKRYLDLLEYKLAFYQKAKALGSVKAVNLPQIPETS |
MerR family regulator protein | B | 137 | Influenza A Virus (A/Bilthoven/17938/1969(H3N2)) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | NAMTYTTAKAAEKIGISAYTLRFYDKEGLLPNVGRDEYGNRRFTDKDLQWLSLLQCLKNTGMSLKDIKRFAECTIIGDDTIEERLSLFENQTKNVKCQIAELKRYLDLLEYKLAFYQKAKALGSVKAVNLPQIPETS |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-08-17 Deposition Author(s): Chang, C.W. , Chen, N.H. , Counago, R.M. , Djoko, K.Y. , Kobe, B. , Mcewan, A.G.