Crystal structure of the atp binding domain of s. aureus gyrb complexed with a ligand
PDB DOI: 10.2210/pdb5d7r/pdb
Classification: ISOMERASE/ISOMERASE INHIBITOR Organism(s): Staphylococcus Aureus
Deposited: 2015-08-14 Deposition Author(s): Andersen, O.A. , Barker, J. , Cheng, R.K. , Cross, J.B. , Dolle, R.E. , Felicetti, B. , Kahmann, J. , Lippa, B. , Romero, J.A.C. , Ryan, M.D. , Scheich, C. , Wood, M. , Yang, Q. , Zhang, J.
Crystal structure of the atp binding domain of s. aureus gyrb complexed with a ligand
Andersen, O.A. , Barker, J. , Cheng, R.K. , Cross, J.B. , Dolle, R.E. , Felicetti, B. , Kahmann, J. , Lippa, B. , Romero, J.A.C. , Ryan, M.D. , Scheich, C. , Wood, M. , Yang, Q. , Zhang, J.
Primary Citation of Related Structures: 5D7R
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DNA gyrase subunit B | A | 212 | Staphylococcus Aureus | GSVTALSDVNNTDNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYEGGIK |
| DNA gyrase subunit B | B | 212 | Staphylococcus Aureus | GSVTALSDVNNTDNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYEGGIK |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-08-14 Deposition Author(s): Andersen, O.A. , Barker, J. , Cheng, R.K. , Cross, J.B. , Dolle, R.E. , Felicetti, B. , Kahmann, J. , Lippa, B. , Romero, J.A.C. , Ryan, M.D. , Scheich, C. , Wood, M. , Yang, Q. , Zhang, J.