5D7F
X-ray structure of ca(2+)-s100b with human rage-derived w72 peptide
PDB DOI: 10.2210/pdb5d7f/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2015-08-13 Deposition Author(s): Colbert, C.L. , Jensen, J.L.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.3 Å
X-ray structure of ca(2+)-s100b with human rage-derived w72 peptide
Primary Citation of Related Structures: 5D7F
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protein S100-B | A | 92 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE |
| Protein S100-B | B | 92 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE |
| Advanced glycosylation end product-specific receptor | P | 15 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SPQGGGPWDSVARVL |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2015-08-13 Deposition Author(s): Colbert, C.L. , Jensen, J.L.