Crystal structure of taf14 yeats domain in complex with h3k9ac
PDB DOI: 10.2210/pdb5d7e/pdb
Classification: NUCLEAR PROTEIN Organism(s): Pseudomonas Chlororaphis Subsp. Piscium , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2015-08-13 Deposition Author(s): Andrews, F.H. , Kutateladze, T.G. , Shanle, E.K. , Strahl, B.D.
Crystal structure of taf14 yeats domain in complex with h3k9ac
Andrews, F.H. , Kutateladze, T.G. , Shanle, E.K. , Strahl, B.D.
Primary Citation of Related Structures: 5D7E
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Transcription initiation factor TFIID subunit 14 | A | 140 | Pseudomonas Chlororaphis Subsp. Piscium , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | LGSMVATVKRTIRIKTQQHILPEVPPVENFPVRQWSIEIVLLDDEGKEIPATIFDKVIYHLHPTFANPNRTFTDPPFRIEEQGWGGFPLDISVFLLEKAGERKIPHDLNFLQESYEVEHVIQIPLNKPLLTEELAKSGST |
H3K9ac | C | 8 | Pseudomonas Chlororaphis Subsp. Piscium , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AQTARKST |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-08-13 Deposition Author(s): Andrews, F.H. , Kutateladze, T.G. , Shanle, E.K. , Strahl, B.D.