Crystal structure of human hsf1 with satellite iii repeat dna
PDB DOI: 10.2210/pdb5d5v/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2015-08-11 Deposition Author(s): Bracher, A. , Hartl, F.U. , Hayer-Hartl, M. , Neudegger, T. , Verghese, J.
Crystal structure of human hsf1 with satellite iii repeat dna
Bracher, A. , Hartl, F.U. , Hayer-Hartl, M. , Neudegger, T. , Verghese, J.
Primary Citation of Related Structures: 5D5V
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Heat shock factor protein 1 | B | 131 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GAMGSGILRGGMDLPVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVT |
Heat shock factor protein 1 | D | 131 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GAMGSGILRGGMDLPVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVT |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-08-11 Deposition Author(s): Bracher, A. , Hartl, F.U. , Hayer-Hartl, M. , Neudegger, T. , Verghese, J.