5D53
In meso in situ serial x-ray crystallography structure of insulin at 100 k
PDB DOI: 10.2210/pdb5d53/pdb
Classification: HORMONE Organism(s): Sus Scrofa
Deposited: 2015-08-10 Deposition Author(s): Caffrey, M. , Diederichs, K. , Huang, C.-Y. , Olieric, V. , Wang, M.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.5 Å
In meso in situ serial x-ray crystallography structure of insulin at 100 k
Caffrey, M. , Diederichs, K. , Huang, C.-Y. , Olieric, V. , Wang, M.
Primary Citation of Related Structures: 5D53
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Insulin B chain | A | 21 | Sus Scrofa | GIVEQCCTSICSLYQLENYCN |
| Insulin A chain | B | 30 | Sus Scrofa | FVNQHLCGSHLVEALYLVCGERGFFYTPKA |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2015-08-10 Deposition Author(s): Caffrey, M. , Diederichs, K. , Huang, C.-Y. , Olieric, V. , Wang, M.