In meso in situ serial x-ray crystallography structure of insulin at room temperature
PDB DOI: 10.2210/pdb5d52/pdb
Classification: HORMONE Organism(s): Human Metapneumovirus
Deposited: 2015-08-10 Deposition Author(s): Caffrey, M. , Diederichs, K. , Huang, C.-Y. , Olieric, V. , Wang, M. , Warshamanage, R.
In meso in situ serial x-ray crystallography structure of insulin at room temperature
Caffrey, M. , Diederichs, K. , Huang, C.-Y. , Olieric, V. , Wang, M. , Warshamanage, R.
Primary Citation of Related Structures: 5D52
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Insulin A chain | A | 21 | Human Metapneumovirus | GIVEQCCTSICSLYQLENYCN |
Insulin B chain | B | 30 | Human Metapneumovirus | FVNQHLCGSHLVEALYLVCGERGFFYTPKA |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-08-10 Deposition Author(s): Caffrey, M. , Diederichs, K. , Huang, C.-Y. , Olieric, V. , Wang, M. , Warshamanage, R.