Crystal structure of arar(dbd) in complex with operator ore1
PDB DOI: 10.2210/pdb5d4r/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Bacillus Subtilis (Strain 168) , Synthetic Construct
Deposited: 2015-08-08 Deposition Author(s): Jain, D. , Nair, D.T. , Narayanan, N.
Crystal structure of arar(dbd) in complex with operator ore1
Jain, D. , Nair, D.T. , Narayanan, N.
Primary Citation of Related Structures: 5D4R
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Arabinose metabolism transcriptional repressor | A | 88 | Bacillus Subtilis (Strain 168) , Synthetic Construct | MHHHHHHLEVLFQGPLGSEFMLPKYAQVKEEISSWINQGKILPDQKIPTENELMQQFGVSRHTIRKAIGDLVSQGLLYSVQGGGTFVA |
Arabinose metabolism transcriptional repressor | B | 88 | Bacillus Subtilis (Strain 168) , Synthetic Construct | MHHHHHHLEVLFQGPLGSEFMLPKYAQVKEEISSWINQGKILPDQKIPTENELMQQFGVSRHTIRKAIGDLVSQGLLYSVQGGGTFVA |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-08-08 Deposition Author(s): Jain, D. , Nair, D.T. , Narayanan, N.