Wild-type bacillus subtilis lipase a with 10% [bmim][cl]
PDB DOI: 10.2210/pdb5ct5/pdb
Classification: HYDROLASE Organism(s): Bacillus Subtilis
Deposited: 2015-07-23 Deposition Author(s): Kaar, J.L. , Nordwald, E.M. , Plaks, J.G. , Snell, J.R. , Sousa, M.C.
Wild-type bacillus subtilis lipase a with 10% [bmim][cl]
Kaar, J.L. , Nordwald, E.M. , Plaks, J.G. , Snell, J.R. , Sousa, M.C.
Primary Citation of Related Structures: 5CT5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Wild-type Bacillus subtilis lipase A with 10% [BMIM][Cl] chain A | A | 180 | Bacillus Subtilis | EHNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN |
| Wild-type Bacillus subtilis lipase A with 10% [BMIM][Cl] chain A | B | 180 | Bacillus Subtilis | EHNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-07-23 Deposition Author(s): Kaar, J.L. , Nordwald, E.M. , Plaks, J.G. , Snell, J.R. , Sousa, M.C.