Crystal structure of plasmodium falciparum diadenosine triphosphate hydrolase in complex with cyclomarin a
PDB DOI: 10.2210/pdb5cs2/pdb
Classification: HYDROLASE Organism(s): Plasmodium Falciparum 3D7 , Streptomyces
Deposited: 2015-07-23 Deposition Author(s): Delmas, C. , Gerhartz, B. , Hinniger, A. , Ostermann, N. , Schmitt, E.
Crystal structure of plasmodium falciparum diadenosine triphosphate hydrolase in complex with cyclomarin a
Delmas, C. , Gerhartz, B. , Hinniger, A. , Ostermann, N. , Schmitt, E.
Primary Citation of Related Structures: 5CS2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Histidine triad protein | A | 201 | Plasmodium Falciparum 3D7 , Streptomyces | GPEKYKNILEKLEWYKNKSSEKYEFGIYEIDKREVFITTKYSYGFVNNKPLLPGHILLTTLKKKKHYNDLDIEEIIDINLLCNFMCYIMGNLFNTTDFSIAIQDGKEAGQTVDHVHIHIIPRKINDYKNNDNIYNDMNKINLGYGKNIICNSCNNTINVCSQNEIERNFKLEEFNTSIRSIEQMEEEANLIKSYINEKFSS |
| Cyclomarin A | B | 7 | Plasmodium Falciparum 3D7 , Streptomyces | WLAFVLV |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-07-23 Deposition Author(s): Delmas, C. , Gerhartz, B. , Hinniger, A. , Ostermann, N. , Schmitt, E.