Crystal structure of the cytoplasmic domain of the pseudomonas putida anti-sigma factor pupr
PDB DOI: 10.2210/pdb5cos/pdb
Classification: TRANSCRIPTION Organism(s): Populus Tremula X P. Tremuloides/Amanita Muscaria Mixed Est Library
Deposited: 2015-07-20 Deposition Author(s): Colbert, C.L. , Jensen, J.L.
Crystal structure of the cytoplasmic domain of the pseudomonas putida anti-sigma factor pupr
Primary Citation of Related Structures: 5COS
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Siderophore-interacting protein | A | 86 | Populus Tremula X P. Tremuloides/Amanita Muscaria Mixed Est Library | GAMGMNGQGATSIPGEVAEQAMHWHLELQEPAVSAATLAACMSWRQAHPLHEHAWQRTQVFAQRLREMRSPGQRPLAHAALRPQQS |
Siderophore-interacting protein | B | 86 | Populus Tremula X P. Tremuloides/Amanita Muscaria Mixed Est Library | GAMGMNGQGATSIPGEVAEQAMHWHLELQEPAVSAATLAACMSWRQAHPLHEHAWQRTQVFAQRLREMRSPGQRPLAHAALRPQQS |
Siderophore-interacting protein | C | 86 | Populus Tremula X P. Tremuloides/Amanita Muscaria Mixed Est Library | GAMGMNGQGATSIPGEVAEQAMHWHLELQEPAVSAATLAACMSWRQAHPLHEHAWQRTQVFAQRLREMRSPGQRPLAHAALRPQQS |
Siderophore-interacting protein | D | 86 | Populus Tremula X P. Tremuloides/Amanita Muscaria Mixed Est Library | GAMGMNGQGATSIPGEVAEQAMHWHLELQEPAVSAATLAACMSWRQAHPLHEHAWQRTQVFAQRLREMRSPGQRPLAHAALRPQQS |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-07-20 Deposition Author(s): Colbert, C.L. , Jensen, J.L.