Crystal structure of human zinc insulin at ph 6.5
PDB DOI: 10.2210/pdb5co9/pdb
Classification: HORMONE Organism(s): Salmonella Enterica
Deposited: 2015-07-20 Deposition Author(s): Lima, L.M.T.R. , Palmieri, L.C.
Crystal structure of human zinc insulin at ph 6.5
Lima, L.M.T.R. , Palmieri, L.C.
Primary Citation of Related Structures: 5CO9
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Insulin | A | 21 | Salmonella Enterica | GIVEQCCTSICSLYQLENYCN |
Insulin | C | 21 | Salmonella Enterica | GIVEQCCTSICSLYQLENYCN |
Insulin | B | 30 | Salmonella Enterica | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Insulin | D | 30 | Salmonella Enterica | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-07-20 Deposition Author(s): Lima, L.M.T.R. , Palmieri, L.C.