Artificial hiv fusion inhibitor ap3 fused to the c-terminus of gp41 nhr
PDB DOI: 10.2210/pdb5cmz/pdb
Classification: VIRAL PROTEIN/INHIBITOR Organism(s): Human Immunodeficiency Virus 1 , Synthetic Construct
Deposited: 2015-07-17 Deposition Author(s): Ye, S. , Zhang, R. , Zhu, Y.
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Envelope glycoprotein | A | 46 | Human Immunodeficiency Virus 1 , Synthetic Construct | SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQX |
Envelope glycoprotein | C | 46 | Human Immunodeficiency Virus 1 , Synthetic Construct | SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQX |
Artificial HIV entry inhibitor AP3 | B | 38 | Human Immunodeficiency Virus 1 , Synthetic Construct | XMTWEEWDKKIEELIKKSEELIKKIEEQIKKQEESIKK |
Artificial HIV entry inhibitor AP3 | D | 38 | Human Immunodeficiency Virus 1 , Synthetic Construct | XMTWEEWDKKIEELIKKSEELIKKIEEQIKKQEESIKK |
Method: X-RAY DIFFRACTION