Artificial hiv fusion inhibitor ap3 fused to the c-terminus of gp41 nhr
PDB DOI: 10.2210/pdb5cmz/pdb
Classification: VIRAL PROTEIN/INHIBITOR Organism(s): Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2015-07-17 Deposition Author(s): Ye, S. , Zhang, R. , Zhu, Y.
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Envelope glycoprotein | A | 46 | Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQX |
Envelope glycoprotein | C | 46 | Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQX |
Artificial HIV entry inhibitor AP3 | B | 38 | Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XMTWEEWDKKIEELIKKSEELIKKIEEQIKKQEESIKK |
Artificial HIV entry inhibitor AP3 | D | 38 | Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XMTWEEWDKKIEELIKKSEELIKKIEEQIKKQEESIKK |
Method: X-RAY DIFFRACTION