5C3G
Crystal structure of bcl-xl bound to bim-mm
PDB DOI: 10.2210/pdb5c3g/pdb
Classification: APOPTOSIS Organism(s): Salmonella Enterica , Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2015-06-17 Deposition Author(s): Edwards, T.A. , Miles, J.A. , Pask, C.M. , Rodriguez-Marin, S. , Rowell, P. , Warriner, S.L. , Wilson, A.J. , Yeo, D.J.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.45 Å
Crystal structure of bcl-xl bound to bim-mm
Edwards, T.A. , Miles, J.A. , Pask, C.M. , Rodriguez-Marin, S. , Rowell, P. , Warriner, S.L. , Wilson, A.J. , Yeo, D.J.
Primary Citation of Related Structures: 5C3G
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Bcl-2-like protein 1,Bcl-2-like protein 1 | A | 153 | Salmonella Enterica , Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MSQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQER |
| Bcl-2-like protein 11 | B | 22 | Salmonella Enterica , Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XIWIAQELRLIGDLFNAYYARR |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2015-06-17 Deposition Author(s): Edwards, T.A. , Miles, J.A. , Pask, C.M. , Rodriguez-Marin, S. , Rowell, P. , Warriner, S.L. , Wilson, A.J. , Yeo, D.J.