Crystal structure of jarid1a phd finger bound to histone h3c4me3 peptide
PDB DOI: 10.2210/pdb5c11/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2015-06-12 Deposition Author(s): Huang, J. , Li, H.
Method: X-RAY DIFFRACTION Resolution: 2.803 Å
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Lysine-specific demethylase 5A | A | 52 | Homo Sapiens , Synthetic Construct | SVCAAQNCQRPCKDKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCA |
H3 peptide | B | 10 | Homo Sapiens , Synthetic Construct | ARTXQTARKS |
Method: X-RAY DIFFRACTION