Hypoxanthine-guanine-xanthine phosphoribosyltransferase (hgxprt) from sulfolobus solfataricus with xanthosine and phosphate bound in the nucleotide binding site and with sulfate bound in the pyrophosphate binding site
PDB DOI: 10.2210/pdb5bqp/pdb
Classification: TRANSFERASE Organism(s): Sulfolobus Solfataricus (Strain Atcc 35092 / Dsm 1617 / Jcm 11322 / P2)
Deposited: 2015-05-29 Deposition Author(s): Christoffersen, S.
Method: X-RAY DIFFRACTION Resolution: 1.7 Å
Hypoxanthine-guanine-xanthine phosphoribosyltransferase (hgxprt) from sulfolobus solfataricus with xanthosine and phosphate bound in the nucleotide binding site and with sulfate bound in the pyrophosphate binding site
Primary Citation of Related Structures: 5BQP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Purine phosphoribosyltransferase (GpT-2) | A | 179 | Sulfolobus Solfataricus (Strain Atcc 35092 / Dsm 1617 / Jcm 11322 / P2) | MVEYHIPSWDEIEDAVFSIGEALVKSNYIPDVLIAVLTGGIIPAKLLSDLLDLKVIRYIDIKFYRSVGKTESKPVIRSVYTDSLEGKKVLVVDDVADTGETLEAVSNVITMFNPAKVMTAALYLKPWSKRIPDFYYKQIDKWIIFPWDKWDVVRENSNVPVDKKERFLNLYNQLLKIRK |
| Purine phosphoribosyltransferase (GpT-2) | B | 179 | Sulfolobus Solfataricus (Strain Atcc 35092 / Dsm 1617 / Jcm 11322 / P2) | MVEYHIPSWDEIEDAVFSIGEALVKSNYIPDVLIAVLTGGIIPAKLLSDLLDLKVIRYIDIKFYRSVGKTESKPVIRSVYTDSLEGKKVLVVDDVADTGETLEAVSNVITMFNPAKVMTAALYLKPWSKRIPDFYYKQIDKWIIFPWDKWDVVRENSNVPVDKKERFLNLYNQLLKIRK |
| Purine phosphoribosyltransferase (GpT-2) | C | 179 | Sulfolobus Solfataricus (Strain Atcc 35092 / Dsm 1617 / Jcm 11322 / P2) | MVEYHIPSWDEIEDAVFSIGEALVKSNYIPDVLIAVLTGGIIPAKLLSDLLDLKVIRYIDIKFYRSVGKTESKPVIRSVYTDSLEGKKVLVVDDVADTGETLEAVSNVITMFNPAKVMTAALYLKPWSKRIPDFYYKQIDKWIIFPWDKWDVVRENSNVPVDKKERFLNLYNQLLKIRK |
| Purine phosphoribosyltransferase (GpT-2) | D | 179 | Sulfolobus Solfataricus (Strain Atcc 35092 / Dsm 1617 / Jcm 11322 / P2) | MVEYHIPSWDEIEDAVFSIGEALVKSNYIPDVLIAVLTGGIIPAKLLSDLLDLKVIRYIDIKFYRSVGKTESKPVIRSVYTDSLEGKKVLVVDDVADTGETLEAVSNVITMFNPAKVMTAALYLKPWSKRIPDFYYKQIDKWIIFPWDKWDVVRENSNVPVDKKERFLNLYNQLLKIRK |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-05-29 Deposition Author(s): Christoffersen, S.