The crystal structure of a crustacean hyperglycemic hormone precursor from the kuruma prawn
PDB DOI: 10.2210/pdb5b5i/pdb
Classification: HORMONE Organism(s): Staphylococcus Aureus (Strain Mu50 / Atcc 700699)
Deposited: 2016-05-10 Deposition Author(s): Nagata, K. , Tsutsui, N.
Method: X-RAY DIFFRACTION Resolution: 1.599 Å
The crystal structure of a crustacean hyperglycemic hormone precursor from the kuruma prawn
Primary Citation of Related Structures: 5B5I
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Crustacean hyperglycemic hormones 1 | A | 74 | Staphylococcus Aureus (Strain Mu50 / Atcc 700699) | GSLFDPSCTGVFDRQLLRRLGRVCDDCFNVFREPNVATECRSNCYNNPVFRQCMAYVVPAHLHNEHREAVQMVG |
Crustacean hyperglycemic hormones 1 | B | 74 | Staphylococcus Aureus (Strain Mu50 / Atcc 700699) | GSLFDPSCTGVFDRQLLRRLGRVCDDCFNVFREPNVATECRSNCYNNPVFRQCMAYVVPAHLHNEHREAVQMVG |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-05-10 Deposition Author(s): Nagata, K. , Tsutsui, N.