The crystal structure of a crustacean hyperglycemic hormone precursor from the kuruma prawn
PDB DOI: 10.2210/pdb5b5i/pdb
Classification: HORMONE Organism(s): Marsupenaeus Japonicus
Deposited: 2016-05-10 Deposition Author(s): Nagata, K. , Tsutsui, N.
The crystal structure of a crustacean hyperglycemic hormone precursor from the kuruma prawn
Primary Citation of Related Structures: 5B5I
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Crustacean hyperglycemic hormones 1 | A | 74 | Marsupenaeus Japonicus | GSLFDPSCTGVFDRQLLRRLGRVCDDCFNVFREPNVATECRSNCYNNPVFRQCMAYVVPAHLHNEHREAVQMVG |
| Crustacean hyperglycemic hormones 1 | B | 74 | Marsupenaeus Japonicus | GSLFDPSCTGVFDRQLLRRLGRVCDDCFNVFREPNVATECRSNCYNNPVFRQCMAYVVPAHLHNEHREAVQMVG |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-05-10 Deposition Author(s): Nagata, K. , Tsutsui, N.