Crystal structure of the leurs editing domain of candida albicans mutant k510a
PDB DOI: 10.2210/pdb5agh/pdb
Classification: LIGASE Organism(s): Candida Albicans
Deposited: 2015-02-02 Deposition Author(s): Cusack, S. , Ghaemi, Z. , Luthey-Schulten, Z. , Martinis, S.A. , Palencia, A. , Seiradake, E. , Zhao, H.
Crystal structure of the leurs editing domain of candida albicans mutant k510a
Cusack, S. , Ghaemi, Z. , Luthey-Schulten, Z. , Martinis, S.A. , Palencia, A. , Seiradake, E. , Zhao, H.
Primary Citation of Related Structures: 5AGH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| POTENTIAL CYTOSOLIC LEUCYL TRNA SYNTHETASE | A | 261 | Candida Albicans | MGYVGIKIRLTDVAPQAQELFKKESLDVKENKVYLVAATLRPETMYGQTCCFVSPKIDYGVFDAGNGDYFITTERAFKNMSFENLTPERGYYKPLFTINGKTLIGSRIDAPYAVNKNLRVLPMETVLATKGTGVVTCVPSDSPDDFVTTRDLANKPEYYGIEKDWVQTDIVPIVHTEKYGDKCAEFLVNDLKIQSPKDSVQLANAKELAYKEGFYNGTMLIGKYKGDKVEDAAPKVKQDLIDEGLAFVYNEPELEHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-02-02 Deposition Author(s): Cusack, S. , Ghaemi, Z. , Luthey-Schulten, Z. , Martinis, S.A. , Palencia, A. , Seiradake, E. , Zhao, H.