Structure of the stapled peptide bound to mdm2
PDB DOI: 10.2210/pdb5afg/pdb
Classification: LIGASE Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2015-01-22 Deposition Author(s): De Andrade, P. , Hyvonen, M. , Lau, Y.H. , Mckenzie, G.J. , Rossmann, M. , Spring, D.R. , Tan, Y.S. , Venkitaraman, A.R. , Wu, Y.
Structure of the stapled peptide bound to mdm2
De Andrade, P. , Hyvonen, M. , Lau, Y.H. , Mckenzie, G.J. , Rossmann, M. , Spring, D.R. , Tan, Y.S. , Venkitaraman, A.R. , Wu, Y.
Primary Citation of Related Structures: 5AFG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| E3 UBIQUITIN-PROTEIN LIGASE MDM2 | A | 97 | Homo Sapiens , Synthetic Construct | GPLGSSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDAAQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLV |
| STAPLED PEPTIDE | B | 12 | Homo Sapiens , Synthetic Construct | LTFAEYWAQLAS |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-01-22 Deposition Author(s): De Andrade, P. , Hyvonen, M. , Lau, Y.H. , Mckenzie, G.J. , Rossmann, M. , Spring, D.R. , Tan, Y.S. , Venkitaraman, A.R. , Wu, Y.