Tbk1 recruitment to cytosol-invading salmonella induces anti- bacterial autophagy
PDB DOI: 10.2210/pdb5aay/pdb
Classification: PROTEIN BINDING Organism(s): Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell)
Deposited: 2015-07-31 Deposition Author(s): Allen, M.D. , Bloor, S. , Bycroft, M. , Holden, D. , Karpiyevitch, M. , Kaul, A. , Komander, D. , Matthews, S. , Randow, F. , Ravenhill, B. , Thurston, T.L.
Method: SOLUTION NMR Resolution: N.A.
Tbk1 recruitment to cytosol-invading salmonella induces anti- bacterial autophagy
Allen, M.D. , Bloor, S. , Bycroft, M. , Holden, D. , Karpiyevitch, M. , Kaul, A. , Komander, D. , Matthews, S. , Randow, F. , Ravenhill, B. , Thurston, T.L.
Primary Citation of Related Structures: 5AAY
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
NF-KAPPA-B ESSENTIAL MODULATOR | A | 30 | Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) | GSPPDFCCPKCQYQAPDMDTLQIHVMECIE |
Method: SOLUTION NMR
Deposited Date: 2015-07-31 Deposition Author(s): Allen, M.D. , Bloor, S. , Bycroft, M. , Holden, D. , Karpiyevitch, M. , Kaul, A. , Komander, D. , Matthews, S. , Randow, F. , Ravenhill, B. , Thurston, T.L.