4ZNY
Structure of the human tsg101-uev domain in complex with the ptap motif of the p19 gag protein of the human t-cell leukemia type i virus
PDB DOI: 10.2210/pdb4zny/pdb
Classification: PROTEIN TRANSPORT Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2015-05-05 Deposition Author(s): Bacarizo, J. , Camara-Artigas, A.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.4 Å
Structure of the human tsg101-uev domain in complex with the ptap motif of the p19 gag protein of the human t-cell leukemia type i virus
Bacarizo, J. , Camara-Artigas, A.
Primary Citation of Related Structures: 4ZNY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tumor susceptibility gene 101 protein | A | 142 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP |
| T-cell leukemia virus type I, partial gag gene; HTLV1 (human T-lymphotropic virus type I) | B | 10 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | YVEPTAPQVL |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2015-05-05 Deposition Author(s): Bacarizo, J. , Camara-Artigas, A.