C domain of staphylococcal protein a mutant - q9w
PDB DOI: 10.2210/pdb4zmd/pdb
Classification: PROTEIN BINDING Organism(s): Staphylococcus Aureus
Deposited: 2015-05-03 Deposition Author(s): Deis, L.N. , Oas, T.G.
Method: X-RAY DIFFRACTION Resolution: 1.87 Å
C domain of staphylococcal protein a mutant - q9w
Primary Citation of Related Structures: 4ZMD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Immunoglobulin G-binding protein A | A | 58 | Staphylococcus Aureus | ADNKFNKEWQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK |
| Immunoglobulin G-binding protein A | B | 58 | Staphylococcus Aureus | ADNKFNKEWQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-05-03 Deposition Author(s): Deis, L.N. , Oas, T.G.