N-terminal structure of ankyrin repeat-containing protein lega11 from legionella pneumophila
PDB DOI: 10.2210/pdb4zhb/pdb
Classification: Structural Genomics, Unknown Function Organism(s): Escherichia Coli , Legionella Pneumophila Subsp. Pneumophila (Strain Philadelphia 1 / Atcc 33152 / Dsm 7513)
Deposited: 2015-04-24 Deposition Author(s): Chang, C. , Endres, M. , Joachimiak, A. , Mack, J. , Midwest Center For Structural Genomics (Mcsg)
Method: X-RAY DIFFRACTION Resolution: 1.3 Å
N-terminal structure of ankyrin repeat-containing protein lega11 from legionella pneumophila
Chang, C. , Endres, M. , Joachimiak, A. , Mack, J. , Midwest Center For Structural Genomics (Mcsg)
Primary Citation of Related Structures: 4ZHB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ankyrin repeat-containing protein | A | 114 | Escherichia Coli , Legionella Pneumophila Subsp. Pneumophila (Strain Philadelphia 1 / Atcc 33152 / Dsm 7513) | MIKMGRSEMKIASAELRELMKAVSEGHYETVNTILDKDPELVNQYAPPTYDSPLARVLNKKHIDYKMLDILVKHHVDFDYPINYHKETPIELACKNQDLQLFKYLVQHNAPISE |
| 5-mer peptide | B | 5 | Escherichia Coli , Legionella Pneumophila Subsp. Pneumophila (Strain Philadelphia 1 / Atcc 33152 / Dsm 7513) | VDAVN |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-04-24 Deposition Author(s): Chang, C. , Endres, M. , Joachimiak, A. , Mack, J. , Midwest Center For Structural Genomics (Mcsg)