4ZGM
Crystal structure of semaglutide peptide backbone in complex with the glp-1 receptor extracellular domain
PDB DOI: 10.2210/pdb4zgm/pdb
Classification: SIGNALING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2015-04-23 Deposition Author(s): Reedtz-Runge, S.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.8 Å
Crystal structure of semaglutide peptide backbone in complex with the glp-1 receptor extracellular domain
Primary Citation of Related Structures: 4ZGM
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Glucagon-like peptide 1 receptor | A | 122 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY |
| Semaglutide peptide backbone; 8Aib,34R-GLP-1(7-37)-OH | B | 31 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2015-04-23 Deposition Author(s): Reedtz-Runge, S.