Hypoxanthine-guanine-xanthine phosphoribosyltransferase (hgxprt) from sulfolobus solfataricus containing gmp complexed in two different ways together with one or two mg2+
PDB DOI: 10.2210/pdb4zfn/pdb
Classification: TRANSFERASE Organism(s): Sulfolobus Solfataricus P2
Deposited: 2015-04-21 Deposition Author(s): Christoffersen, S.
Hypoxanthine-guanine-xanthine phosphoribosyltransferase (hgxprt) from sulfolobus solfataricus containing gmp complexed in two different ways together with one or two mg2+
Primary Citation of Related Structures: 4ZFN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Purine phosphoribosyltransferase (GpT-2) | A | 179 | Sulfolobus Solfataricus P2 | MVEYHIPSWDEIEDAVFSIGEALVKSNYIPDVLIAVLTGGIIPAKLLSDLLDLKVIRYIDIKFYRSVGKTESKPVIRSVYTDSLEGKKVLVVDDVADTGETLEAVSNVITMFNPAKVMTAALYLKPWSKRIPDFYYKQIDKWIIFPWDKWDVVRENSNVPVDKKERFLNLYNQLLKIRK |
| Purine phosphoribosyltransferase (GpT-2) | B | 179 | Sulfolobus Solfataricus P2 | MVEYHIPSWDEIEDAVFSIGEALVKSNYIPDVLIAVLTGGIIPAKLLSDLLDLKVIRYIDIKFYRSVGKTESKPVIRSVYTDSLEGKKVLVVDDVADTGETLEAVSNVITMFNPAKVMTAALYLKPWSKRIPDFYYKQIDKWIIFPWDKWDVVRENSNVPVDKKERFLNLYNQLLKIRK |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-04-21 Deposition Author(s): Christoffersen, S.