4ZDT
Crystal structure of the ring finger domain of slx1 in complex with the c-terminal domain of slx4
PDB DOI: 10.2210/pdb4zdt/pdb
Classification: HYDROLASE Organism(s): Schizosaccharomyces Pombe (Strain 972 / Atcc 24843)
Deposited: 2015-04-19 Deposition Author(s): Lian, F.M. , Qian, C.M. , Xie, S.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2 Å
Crystal structure of the ring finger domain of slx1 in complex with the c-terminal domain of slx4
Lian, F.M. , Qian, C.M. , Xie, S.
Primary Citation of Related Structures: 4ZDT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Structure-specific endonuclease subunit slx1 | A | 73 | Schizosaccharomyces Pombe (Strain 972 / Atcc 24843) | MEPVKCNLCYECIESDELRANCPFTDCNSINHLTCLASSFLTEECQVLPIEGMCTKCKRVLRWREFLSTVFTT |
| Structure-specific endonuclease subunit slx1 | C | 73 | Schizosaccharomyces Pombe (Strain 972 / Atcc 24843) | MEPVKCNLCYECIESDELRANCPFTDCNSINHLTCLASSFLTEECQVLPIEGMCTKCKRVLRWREFLSTVFTT |
| Structure-specific endonuclease subunit slx4 | B | 71 | Schizosaccharomyces Pombe (Strain 972 / Atcc 24843) | GSMIVTQTHRAISQVVKQAKDNSVWIKILTYSAIDVEEFQLWLKRKNLNVSLDLIKSWCDKYGVLMKGSWH |
| Structure-specific endonuclease subunit slx4 | D | 71 | Schizosaccharomyces Pombe (Strain 972 / Atcc 24843) | GSMIVTQTHRAISQVVKQAKDNSVWIKILTYSAIDVEEFQLWLKRKNLNVSLDLIKSWCDKYGVLMKGSWH |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2015-04-19 Deposition Author(s): Lian, F.M. , Qian, C.M. , Xie, S.