4Z0R
Crystal structure of the cw domain of zcwpw2 mutant f78r in complex with histone h3 peptide
PDB DOI: 10.2210/pdb4z0r/pdb
Classification: PROTEIN BINDING/STRUCTURAL PROTEIN Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2015-03-26 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Liu, Y. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.75 Å
Crystal structure of the cw domain of zcwpw2 mutant f78r in complex with histone h3 peptide
Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Liu, Y. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W.
Primary Citation of Related Structures: 4Z0R
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Zinc finger CW-type PWWP domain protein 2 | A | 59 | Homo Sapiens , Synthetic Construct | GVENMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNNCSISEEDR |
| Zinc finger CW-type PWWP domain protein 2 | B | 59 | Homo Sapiens , Synthetic Construct | GVENMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNNCSISEEDR |
| Zinc finger CW-type PWWP domain protein 2 | C | 59 | Homo Sapiens , Synthetic Construct | GVENMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNNCSISEEDR |
| Histone H3.1 | D | 16 | Homo Sapiens , Synthetic Construct | ARTKQTARKSTGGKAX |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2015-03-26 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Liu, Y. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W.