Advanced Search:
4YYP
Crystal structure of human plk4-pb3 in complex with stil-cc
PDB DOI: 10.2210/pdb4yyp/pdb
Classification: TRANSFERASE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2015-03-24 Deposition Author(s): Arquint, C. , Boehm, R. , Gabryjonczyk, A. , Hiller, S. , Imseng, S. , Maier, T. , Nigg, E.A. , Sauer, E.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.6 Å
Crystal structure of human plk4-pb3 in complex with stil-cc
Arquint, C. , Boehm, R. , Gabryjonczyk, A. , Hiller, S. , Imseng, S. , Maier, T. , Nigg, E.A. , Sauer, E.
Primary Citation of Related Structures: 4YYP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Serine/threonine-protein kinase PLK4 | A | 87 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SAQLLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSISYTSPNGQTTRYGENEKLPDYIKQKLQCLSSILLMFSNPTPNFH |
| SCL-interrupting locus protein | B | 32 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PDAYRFLTEQDRQLRLLQAQIQRLLEAQSLMP |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2015-03-24 Deposition Author(s): Arquint, C. , Boehm, R. , Gabryjonczyk, A. , Hiller, S. , Imseng, S. , Maier, T. , Nigg, E.A. , Sauer, E.