Crystal structure of taf1 bd2 bromodomain bound to a crotonyllysine peptide
PDB DOI: 10.2210/pdb4yyn/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2015-03-24 Deposition Author(s): Bellon, S. , Cochran, A.G. , Poy, F. , Tang, Y.
Crystal structure of taf1 bd2 bromodomain bound to a crotonyllysine peptide
Bellon, S. , Cochran, A.G. , Poy, F. , Tang, Y.
Primary Citation of Related Structures: 4YYN
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Transcription initiation factor TFIID subunit 1 | A | 144 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSPLLDDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEEAELESLDPMT |
Transcription initiation factor TFIID subunit 1 | B | 144 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSPLLDDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEEAELESLDPMT |
Histone H4 | Z | 11 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SGRGXGGXGLG |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-03-24 Deposition Author(s): Bellon, S. , Cochran, A.G. , Poy, F. , Tang, Y.