PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

4YYG

Crystal structure of brd9 bromodomain bound to a butyryllysine peptide

PDB DOI: 10.2210/pdb4yyg/pdb

Classification: PROTEIN BINDING
Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2015-03-23
Deposition Author(s): Bellon, S. , Cochran, A.G. , Poy, F. , Tang, Y.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 2.1 Å

Literature

Crystal structure of brd9 bromodomain bound to a butyryllysine peptide

Bellon, S. , Cochran, A.G. , Poy, F. , Tang, Y.

Primary Citation of Related Structures: 4YYG


Proteins
Molecule Chains Sequence Length Organism Sequence
Bromodomain-containing protein 9 A 108 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GSAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSK
Histone H4 B 11 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) SGRGXGGXGLG
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2015-03-23
Deposition Author(s): Bellon, S. , Cochran, A.G. , Poy, F. , Tang, Y.