Spao(spoa1,2)
PDB DOI: 10.2210/pdb4yx5/pdb
Classification: PROTEIN TRANSPORT Organism(s): Salmonella Typhimurium , Salmonella Typhimurium (Strain Lt2 / Sgsc1412 / Atcc 700720)
Deposited: 2015-03-22 Deposition Author(s): Notti, R.Q. , Stebbins, C.E.
Method: X-RAY DIFFRACTION Resolution: 2.9001 Å
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Surface presentation of antigens protein SpaO | A | 73 | Salmonella Typhimurium , Salmonella Typhimurium (Strain Lt2 / Sgsc1412 / Atcc 700720) | GPVDPKMLRWPLRFVIGSSDTQRSLLGRIGIGDVLLIRTSRAEVYCYAKKLGHFNRVEGGIIVETLDIQHIEE |
| Surface presentation of antigens protein SpaO | B | 70 | Salmonella Typhimurium , Salmonella Typhimurium (Strain Lt2 / Sgsc1412 / Atcc 700720) | GPVDVKLEFVLYRKNVTLAELEAMGQQQLLSLPTNAELNVEIMANGVLLGNGELVQMNDTLGVEIHEWLS |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-03-22 Deposition Author(s): Notti, R.Q. , Stebbins, C.E.