Structural insight into divalent galactoside binding to pseudomonas aeruginosa lectin leca
PDB DOI: 10.2210/pdb4yw6/pdb
Classification: SUGAR BINDING PROTEIN Organism(s): Pseudomonas Aeruginosa
Deposited: 2015-03-20 Deposition Author(s): Bergmann, M. , Darbre, T. , Gillon, E. , Imberty, A. , Jin, X. , Michaud, G. , Pieters, R. , Reymond, J.-L. , Stocker, A. , Visini, R.
Structural insight into divalent galactoside binding to pseudomonas aeruginosa lectin leca
Bergmann, M. , Darbre, T. , Gillon, E. , Imberty, A. , Jin, X. , Michaud, G. , Pieters, R. , Reymond, J.-L. , Stocker, A. , Visini, R.
Primary Citation of Related Structures: 4YW6
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PA-I galactophilic lectin | A | 121 | Pseudomonas Aeruginosa | AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS |
| PA-I galactophilic lectin | B | 121 | Pseudomonas Aeruginosa | AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS |
| PA-I galactophilic lectin | C | 121 | Pseudomonas Aeruginosa | AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS |
| PA-I galactophilic lectin | D | 121 | Pseudomonas Aeruginosa | AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-03-20 Deposition Author(s): Bergmann, M. , Darbre, T. , Gillon, E. , Imberty, A. , Jin, X. , Michaud, G. , Pieters, R. , Reymond, J.-L. , Stocker, A. , Visini, R.