Crystal structure of mdm35
PDB DOI: 10.2210/pdb4ytv/pdb
Classification: PROTEIN BINDING Organism(s): Saccharomyces Cerevisiae
Deposited: 2015-03-18 Deposition Author(s): Endo, T. , Kawano, S. , Tamura, Y. , Watanabe, Y.
Method: X-RAY DIFFRACTION Resolution: 1.45 Å
Crystal structure of mdm35
Endo, T. , Kawano, S. , Tamura, Y. , Watanabe, Y.
Primary Citation of Related Structures: 4YTV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Mitochondrial distribution and morphology protein 35 | A | 84 | Saccharomyces Cerevisiae | GPHMGNIMSASFAPECTDLKTKYDSCFNEWYSEKFLKGKSVENECSKQWYAYTTCVNAALVKQGIKPALDEAREEAPFENGGKL |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-03-18 Deposition Author(s): Endo, T. , Kawano, S. , Tamura, Y. , Watanabe, Y.