Structure of usp7 with a novel viral protein
PDB DOI: 10.2210/pdb4ysi/pdb
Classification: HYDROLASE/Peptide Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2015-03-17 Deposition Author(s): Chavoshi, S. , Saridakis, V.
Structure of usp7 with a novel viral protein
Primary Citation of Related Structures: 4YSI
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Ubiquitin carboxyl-terminal hydrolase 7 | A | 143 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | TSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAW |
SER-PRO-GLY-GLU-GLY-PRO-SER-GLY | B | 8 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SPGEGPSG |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-03-17 Deposition Author(s): Chavoshi, S. , Saridakis, V.