Structure of the c. elegans sas-5 implico dimerization domain
PDB DOI: 10.2210/pdb4ynh/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Human Herpesvirus 6B (Strain Hst)
Deposited: 2015-03-10 Deposition Author(s): Hatzopoulos, G.N. , Rogala, K.B. , Vakonakis, I.
Structure of the c. elegans sas-5 implico dimerization domain
Hatzopoulos, G.N. , Rogala, K.B. , Vakonakis, I.
Primary Citation of Related Structures: 4YNH
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Spindle assembly abnormal protein 5 | A | 60 | Human Herpesvirus 6B (Strain Hst) | GPLGSKIASAREVIKRDGVIPPEALTIIEQRLRSDPMFRQQIDNVLADAECDANRAAYSP |
Spindle assembly abnormal protein 5 | B | 60 | Human Herpesvirus 6B (Strain Hst) | GPLGSKIASAREVIKRDGVIPPEALTIIEQRLRSDPMFRQQIDNVLADAECDANRAAYSP |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-03-10 Deposition Author(s): Hatzopoulos, G.N. , Rogala, K.B. , Vakonakis, I.