Crystal structure of the dm domain of human dmrt1 bound to 25mer target dna
PDB DOI: 10.2210/pdb4yj0/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2015-03-02 Deposition Author(s): Aihara, H. , Banerjee, S. , Bardwell, V.J. , Bashamboo, A. , Gearhart, M.D. , Kurahashi, K. , Lee, J.K. , Loeuille, G. , Mcelreavey, K. , Murphy, M.W. , Rojo, S. , Zarkower, D.
Crystal structure of the dm domain of human dmrt1 bound to 25mer target dna
Aihara, H. , Banerjee, S. , Bardwell, V.J. , Bashamboo, A. , Gearhart, M.D. , Kurahashi, K. , Lee, J.K. , Loeuille, G. , Mcelreavey, K. , Murphy, M.W. , Rojo, S. , Zarkower, D.
Primary Citation of Related Structures: 4YJ0
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Doublesex- and mab-3-related transcription factor 1 | A | 70 | Homo Sapiens , Synthetic Construct | SKKSPRLPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCNLIAERQRVMAAQVALRRQQAQEEELGISHP |
Doublesex- and mab-3-related transcription factor 1 | B | 70 | Homo Sapiens , Synthetic Construct | SKKSPRLPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCNLIAERQRVMAAQVALRRQQAQEEELGISHP |
Doublesex- and mab-3-related transcription factor 1 | C | 70 | Homo Sapiens , Synthetic Construct | SKKSPRLPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCNLIAERQRVMAAQVALRRQQAQEEELGISHP |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-03-02 Deposition Author(s): Aihara, H. , Banerjee, S. , Bardwell, V.J. , Bashamboo, A. , Gearhart, M.D. , Kurahashi, K. , Lee, J.K. , Loeuille, G. , Mcelreavey, K. , Murphy, M.W. , Rojo, S. , Zarkower, D.