Crystal structure of multidrug resistant clinical isolate pr20 with grl-5010a
PDB DOI: 10.2210/pdb4yhq/pdb
Classification: HYDROLASE/HYDROLASE INHIBITOR Organism(s): Human Immunodeficiency Virus Type 1 Group M Subtype
Deposited: 2015-02-27 Deposition Author(s): Agniswamy, J. , Weber, I.T.
Crystal structure of multidrug resistant clinical isolate pr20 with grl-5010a
Primary Citation of Related Structures: 4YHQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protease | A | 99 | Human Immunodeficiency Virus Type 1 Group M Subtype | PQITLWKRPFVTVKVGGQLKEALLDTGADNTIFEDINLPGRWKPKMVGGIGGFLKVREYDQVPIEIAGHKVIGTVLVGPTPVNVIGRDTMTQIGATLNF |
| Protease | B | 99 | Human Immunodeficiency Virus Type 1 Group M Subtype | PQITLWKRPFVTVKVGGQLKEALLDTGADNTIFEDINLPGRWKPKMVGGIGGFLKVREYDQVPIEIAGHKVIGTVLVGPTPVNVIGRDTMTQIGATLNF |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-02-27 Deposition Author(s): Agniswamy, J. , Weber, I.T.