4YGW
Rnase s in complex with stabilized s peptide
PDB DOI: 10.2210/pdb4ygw/pdb
Classification: HYDROLASE Organism(s): Parengyodontium Album , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2015-02-26 Deposition Author(s): Assem, N. , Dawson, P.E. , Ferreira, D. , Wolan, D.W.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.18 Å
Rnase s in complex with stabilized s peptide
Assem, N. , Dawson, P.E. , Ferreira, D. , Wolan, D.W.
Primary Citation of Related Structures: 4YGW
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ribonuclease A C2 | B | 103 | Parengyodontium Album , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2015-02-26 Deposition Author(s): Assem, N. , Dawson, P.E. , Ferreira, D. , Wolan, D.W.