4XZF
Crystal structure of hiran domain of human hltf in complex with dna
PDB DOI: 10.2210/pdb4xzf/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2015-02-04 Deposition Author(s): Hashimoto, H. , Hishiki, A.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.38 Å
Crystal structure of hiran domain of human hltf in complex with dna
Primary Citation of Related Structures: 4XZF
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| (DA)(DC)(DC)(DG)(DC)(DC)(DG)(DG)(DG)(DT)(DG)(DC)(DC) | b | 13 | NA | ACCGCCGGGTGCC |
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Helicase-like transcription factor | A | 122 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSVLFGSLRGHVVGLRYYTGVVNNNEMVALQRDPNNPYDKNAIKVNNVNGNQVGHLKKELAGALAYIMDNKLAQIEGVVPFGANNAFTMPLHMTFWGKEENRKAVSDQLKKHGFKLGPA |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2015-02-04 Deposition Author(s): Hashimoto, H. , Hishiki, A.