Crystal structure of drosophila spinophilin-pdz and a c-terminal peptide of neurexin
PDB DOI: 10.2210/pdb4xhv/pdb
Classification: SIGNALING PROTEIN Organism(s): Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2015-01-06 Deposition Author(s): Bergeron, D. , Boehme, M.A. , Depner, H. , Driller, J.H. , Goettfert, F. , Hell, S.W. , Hollmann, C. , Holt, M. , Loll, B. , Luetzkendorf, J. , Matkovic, T. , Muhammad, K.G.H. , Quentin, C. , Ramesh, N. , Reddy, S. , Rey, U. , Schmoranzer, J. , Sigrist, S.J. , Wahl, M.C. , Walter, A.
Crystal structure of drosophila spinophilin-pdz and a c-terminal peptide of neurexin
Bergeron, D. , Boehme, M.A. , Depner, H. , Driller, J.H. , Goettfert, F. , Hell, S.W. , Hollmann, C. , Holt, M. , Loll, B. , Luetzkendorf, J. , Matkovic, T. , Muhammad, K.G.H. , Quentin, C. , Ramesh, N. , Reddy, S. , Rey, U. , Schmoranzer, J. , Sigrist, S.J. , Wahl, M.C. , Walter, A.
Primary Citation of Related Structures: 4XHV
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
LP20995p | A | 94 | Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GAMAHVFPVELMKGPEGLGLSIIGMGVGADAGLEKLGIFVKTITDNGAAARDGRIQVNDQIIEVDGKSLVGVTQAYAASVLRNTSGLVKFQIGR |
Neurexin 1 | B | 10 | Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | DSKDVKEWYV |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-01-06 Deposition Author(s): Bergeron, D. , Boehme, M.A. , Depner, H. , Driller, J.H. , Goettfert, F. , Hell, S.W. , Hollmann, C. , Holt, M. , Loll, B. , Luetzkendorf, J. , Matkovic, T. , Muhammad, K.G.H. , Quentin, C. , Ramesh, N. , Reddy, S. , Rey, U. , Schmoranzer, J. , Sigrist, S.J. , Wahl, M.C. , Walter, A.