Insulin co-crystallizes in the presence of it beta-cell chaperone sulfatide
PDB DOI: 10.2210/pdb4xc4/pdb
Classification: HORMONE Organism(s): Salmonella Enterica
Deposited: 2014-12-17 Deposition Author(s): Bailey, K.M. , Bracey, A.W. , Buschard, K. , Magis, A.T. , Osterbye, T. , Ostrov, D.A.
Insulin co-crystallizes in the presence of it beta-cell chaperone sulfatide
Bailey, K.M. , Bracey, A.W. , Buschard, K. , Magis, A.T. , Osterbye, T. , Ostrov, D.A.
Primary Citation of Related Structures: 4XC4
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Insulin | A | 21 | Salmonella Enterica | GIVEQCCTSICSLYQLENYCN |
Insulin | C | 21 | Salmonella Enterica | GIVEQCCTSICSLYQLENYCN |
Insulin | B | 30 | Salmonella Enterica | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Insulin | D | 30 | Salmonella Enterica | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-12-17 Deposition Author(s): Bailey, K.M. , Bracey, A.W. , Buschard, K. , Magis, A.T. , Osterbye, T. , Ostrov, D.A.