4X8P
Crystal structure of ash2l spry domain in complex with rbbp5
PDB DOI: 10.2210/pdb4x8p/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2014-12-10 Deposition Author(s): Brand, M. , Brunzelle, J.S. , Chaturvedi, C.P. , Couture, J.-F. , Shilatifard, A. , Skiniotis, G. , Zhang, P.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.2 Å
Crystal structure of ash2l spry domain in complex with rbbp5
Brand, M. , Brunzelle, J.S. , Chaturvedi, C.P. , Couture, J.-F. , Shilatifard, A. , Skiniotis, G. , Zhang, P.
Primary Citation of Related Structures: 4X8P
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Set1/Ash2 histone methyltransferase complex subunit ASH2,Set1/Ash2 histone methyltransferase complex subunit ASH2 | A | 182 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SRVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDISGRGSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMG |
| Retinoblastoma-binding protein 5 | B | 12 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | EYEERESEFDIE |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2014-12-10 Deposition Author(s): Brand, M. , Brunzelle, J.S. , Chaturvedi, C.P. , Couture, J.-F. , Shilatifard, A. , Skiniotis, G. , Zhang, P.