4X1V
Crystal structure of the 2nd sh3 domain from human cd2ap (cms) in complex with a proline-rich peptide (aa 76-91) from human arap1
PDB DOI: 10.2210/pdb4x1v/pdb
Classification: SIGNALING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2014-11-25 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Feller, S.M. , Kirsch, K.H. , Knapp, S. , Krojer, T. , Rouka, E. , Simister, P.C. , Von Delft, F.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.58 Å
Crystal structure of the 2nd sh3 domain from human cd2ap (cms) in complex with a proline-rich peptide (aa 76-91) from human arap1
Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Feller, S.M. , Kirsch, K.H. , Knapp, S. , Krojer, T. , Rouka, E. , Simister, P.C. , Von Delft, F.
Primary Citation of Related Structures: 4X1V
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| CD2-associated protein | A | 65 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSKKRQCKVLFEYIPQNEDELELKVGDIIDINEEVEEGWWSGTLNNKLGLFPSNFVKELEVT |
| Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 | B | 16 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | RPTPRPVPMKRHIFRS |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2014-11-25 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Feller, S.M. , Kirsch, K.H. , Knapp, S. , Krojer, T. , Rouka, E. , Simister, P.C. , Von Delft, F.